DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and serpinb1l2

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:435 Identity:119/435 - (27%)
Similarity:188/435 - (43%) Gaps:71/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ANSV--LNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQF 171
            |||:  |:....|....|.|.. .:|||||..:|:::.|||:|.:..|:..|......|..|..|
Zfish     7 ANSLFALDLYRALSASSAEGNI-FFSPLSISAALSMVYLGARGDTAGEMEKVLCFSSVSDFHAHF 70

  Fly   172 GLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRV 236
            ..::..:..|:              ||..:|              |||.|:.:..::..|.|...
Zfish    71 KTLISSINSPS--------------ASYILR--------------LANRLYGEKTFSFLPMYVDS 107

  Fly   237 IVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRMILANALYFKAFWE 300
            .:::|.::.|..||..:...:|..||.:|.:.|:|.|::::... :.:.||::|.||:|||..|.
Zfish   108 TMKLYHAEPQTVDFIRAADDSRQFINKWVEKQTENQIKDLLQPGVVNEMTRLLLVNAIYFKGNWM 172

  Fly   301 TDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQP- 364
            ..|...||:...|..|...:.|   ||||.....:||....|...:::.|||.....:|.|:.| 
Zfish   173 HTFDAHATKEMPFKINQNESRP---VQMMDQVENFPYRCIPEYKLQVLELPYTQQELSMLILLPD 234

  Fly   365 -FKSSVRELMALQKRLTADKIESMISRMYR---RAALVAFPKMHLTESVNLKTVMQRMGLGGIFS 425
             .|.....|:.|:..|...|:....||...   |..:|..||..|.....|...:::||:..:|.
Zfish   235 EIKYGSDPLLKLESELNLQKLLDWTSRGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVFQ 299

  Fly   426 AVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAA 490
            ..:.||:.:::|                        ||    |.:..::||....|||:||||||
Zfish   300 ETKADLTGMSSN------------------------GG----LFLSAVIHKAFVEVNEEGTEAAA 336

  Fly   491 SSVTYLKKSGPDVLFR---GDTPFMVLVRHDPTKLVLFYGLINEP 532
            ::...|..|.....|.   .|.|||..:||:||..:||.|....|
Zfish   337 ATALLLPISACQGAFHDFIADHPFMFFIRHNPTNSILFLGRFRAP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 115/426 (27%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 118/433 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.