DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb9h

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001357856.1 Gene:Serpinb9h / 544923 MGIID:3709608 Length:377 Species:Mus musculus


Alignment Length:445 Identity:116/445 - (26%)
Similarity:197/445 - (44%) Gaps:98/445 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NILGQHLANG----------------KTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTS 165
            |.|.|  |||                |...|||:||..:||::||||||.:..::.....:....
Mouse     2 NTLSQ--ANGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDE 64

  Fly   166 RLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLN 230
            .:|:.|.|:|.:|.:                     ::|::      :.:.:||.||.:....|.
Mouse    65 DVHQGFQLLLHNLNK---------------------QNNQK------YCLTMANRLFVENTCELL 102

  Fly   231 PDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRMILANALY 294
            |.::...::.|.|:::...|..:...:|.:||.:|::.|...|.::::.| :...||:|||||||
Mouse   103 PTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALY 167

  Fly   295 FKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHED-------HELGCKIIGLPY 352
            |...|...|.::.|:...|..|.:.|.|   ||||       :.||       .|:..:::.:||
Mouse   168 FHGTWCKRFEKNRTKEMPFKINKKETRP---VQMM-------WREDTLFHAYVKEIQAQVLVMPY 222

  Fly   353 RGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISR--MYRRAALVAFPKMHLTESVNLKTVM 415
            .|......::.|.:..  ::..::..||.:|:.:....  |.|....|.:||..|.|..::.:::
Mouse   223 EGIDLNFVVLLPDEGV--DISKVENNLTFEKLTAWTKPEFMNRTEFHVYYPKFQLQEDYDMNSLL 285

  Fly   416 QRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFT 480
            |.:|:..:|...:.|||.::|.|                            :|.:.:.|||....
Mouse   286 QHLGILNVFDGSKADLSGMSTKE----------------------------NLCLSEFVHKCVVE 322

  Fly   481 VNEQGTEAAASSVT--YLKKSGPD-VLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |||:||||||:|..  ....|||| ..|..|.||:..:.|..|..:||.|..:.|
Mouse   323 VNEEGTEAAAASAVEFIFLCSGPDPETFCADHPFLFFIMHSTTNSILFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 114/438 (26%)
Serpinb9hNP_001357856.1 serpinB 7..374 CDD:381072 112/433 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.