DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINA4

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:419 Identity:107/419 - (25%)
Similarity:179/419 - (42%) Gaps:78/419 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GKTQIYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDTSR--LHEQFGLMLQDLQQPTREAI 186
            ||...:|||||..:.|:|.|||...|..::  ...|::.:.|.  :|..|..:|..|..|     
Human   109 GKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLP----- 168

  Fly   187 SAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFE 251
              |..|                     |..:.:.||..........:....:.||.:.|...:|.
Human   169 --GHGL---------------------ETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFY 210

  Fly   252 GSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPN 316
            .:..|.:. ||.:|.:.|:..|.::: |::.:...|:|.|.:||||.||..||.|.|.|.:||.:
Human   211 DTVGTIQL-INDHVKKETRGKIVDLV-SELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVD 273

  Fly   317 GEGTEPVMRVQMMATGGAYP-YHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLT 380
            ...|   :||.||.....:. |..|..|.|.::.:.|:|: :|::.|.|.:..:||   :::.||
Human   274 ENTT---VRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGD-ATVFFILPNQGKMRE---IEEVLT 331

  Fly   381 ADKI----ESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATR 441
            .:.:    ..:..|.:.:...:..||..::.|..|..::.|:|...:||. ..|||         
Human   332 PEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSK-WADLS--------- 386

  Fly   442 TNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAAS---SVTYLKKSGPDV 503
                |....|.|||.:.               .||....|:|.||||||:   ::.:........
Human   387 ----GITKQQKLEASKS---------------FHKATLDVDEAGTEAAAATSFAIKFFSAQTNRH 432

  Fly   504 LFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            :.|.:.||:|::....|:.|||.|.:.:|
Human   433 ILRFNRPFLVVIFSTSTQSVLFLGKVVDP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 105/412 (25%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 106/414 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.