DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINA1

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:444 Identity:110/444 - (24%)
Similarity:193/444 - (43%) Gaps:83/444 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DLATSDRIANSVLNFANILGQHLA---NGKTQIYSPLSIVHSLALLLLGAKGRSYEEL-----ST 157
            |..|.::|..::..||..|.:.||   |.....:||:||..:.|:|.||.|..:::|:     ..
Human    43 DHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFN 107

  Fly   158 VFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLF 222
            :.:||: :::||.|..:|:.|.||..:.                            ::...||||
Human   108 LTEIPE-AQIHEGFQELLRTLNQPDSQL----------------------------QLTTGNGLF 143

  Fly   223 TQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTRM 287
            ...|..|...:...:.::|.|:....:| |....|:..||.||.:.|:..|.::: .::.:.|..
Human   144 LSEGLKLVDKFLEDVKKLYHSEAFTVNF-GDTEEAKKQINDYVEKGTQGKIVDLV-KELDRDTVF 206

  Fly   288 ILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPY 352
            .|.|.::||..||..|....|..::|:.:...|   ::|.||...|.:......:|...::.:.|
Human   207 ALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTT---VKVPMMKRLGMFNIQHCKKLSSWVLLMKY 268

  Fly   353 RGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQR 417
            .||.:.::    |.....:|..|:..||.|.|...:....||:|.:..||:.:|.:.:||:|:.:
Human   269 LGNATAIF----FLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQ 329

  Fly   418 MGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVN 482
            :|:..:||   |...|....|                          .:.|.:...|||...|::
Human   330 LGITKVFS---NGADLSGVTE--------------------------EAPLKLSKAVHKAVLTID 365

  Fly   483 EQGTEAAASSVTYLK----KSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |:|||||.:  .:|:    ...|:|.|  :.||:.|:....||..||.|.:..|
Human   366 EKGTEAAGA--MFLEAIPMSIPPEVKF--NKPFVFLMIEQNTKSPLFMGKVVNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 105/427 (25%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 106/427 (25%)
RCL 368..392 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.