DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINA5

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:459 Identity:116/459 - (25%)
Similarity:197/459 - (42%) Gaps:98/459 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GTSVKPSNLPAAYSNGYVDLATSDRIANSVLNFANILGQHLANGKTQIYSPLSIVHSLALLLLGA 147
            |.:|.||:......:.|..||::                  |..::..:||:||..|||:|.|||
Human    37 GATVAPSSRRDFTFDLYRALASA------------------APSQSIFFSPVSISMSLAMLSLGA 83

  Fly   148 ----KGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQ 208
                |.:..|.|...........||..|..:||:|.||                           
Human    84 GSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQP--------------------------- 121

  Fly   209 RPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHI 273
            |.| .::.|.|.|||.....|...:...:..:|.:|....:|..| |.|...||.|||:.||..|
Human   122 RDG-FQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDS-AGAMKQINDYVAKQTKGKI 184

  Fly   274 ENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYH 338
            .::: .::.....:|:.|.::|||.|||.|....|:..:||..   :|.|:||.||:....|.|.
Human   185 VDLL-KNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVT---SETVVRVPMMSREDQYHYL 245

  Fly   339 EDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKM 403
            .|..|.|:::|:||:||.:.::|:    .|..::..::..|:...:...:....:|...:..||.
Human   246 LDRNLSCRVVGVPYQGNATALFIL----PSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKF 306

  Fly   404 HLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDL 468
            .:..|..|:.|:..:|:..:|:: ..|||.|:.:                            |::
Human   307 SIEGSYQLEKVLPSLGISNVFTS-HADLSGISNH----------------------------SNI 342

  Fly   469 VVDDIVHKVDFTVNEQGTEAAASSVTYL-----KKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGL 528
            .|.::|||....|:|.||.|||::.|..     :.:...::|  :.||::.:..:.   :||.|.
Human   343 QVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVF--NRPFLMFIVDNN---ILFLGK 402

  Fly   529 INEP 532
            :|.|
Human   403 VNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 106/424 (25%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 110/447 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.