DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb3a

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006249702.1 Gene:Serpinb3a / 498209 RGDID:1562868 Length:387 Species:Rattus norvegicus


Alignment Length:449 Identity:113/449 - (25%)
Similarity:205/449 - (45%) Gaps:91/449 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ANSVLNFANILGQHLANGKTQI-YSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSR------ 166
            |.:...|...|.:.|.:.:..| ||||||:.:||:|.|||||.:.:::..|....:|::      
  Rat     5 AKATTQFTLELYRQLRDSEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKVIQFHETTKKTTEKS 69

  Fly   167 --------LHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFT 223
                    :||||..::..|.                      :||      .|::::.||.::.
  Rat    70 ADCHDEESVHEQFQKLMTQLN----------------------KSN------DAYDLNSANSIYG 106

  Fly   224 QTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENII-ASDIPQTTRM 287
            ...:.....:...|.|.|.::::..||..:...:...||::|...|...|:::. ...:..:|.:
  Rat   107 AKHFPFLQTFLEDIKEYYQANVESLDFAHAAEESEKKINSWVENQTNGKIKDLFPKGSLNSSTIL 171

  Fly   288 ILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPY 352
            :|.||:|||..|...|.|..|..|.|:.|...::|   ||||.....:.:....::..|::.:||
  Rat   172 VLVNAVYFKGQWNHKFDEKHTEEDKFWLNKNTSKP---VQMMRQKNEFNFIFLEDVQAKMVEIPY 233

  Fly   353 RGNLSTMYIIQPFKSSVRELMALQKRLTADKI------ESM-ISRMYRRAALVAFPKMHLTESVN 410
            :|...:|:|:.|.:  :..|..|:::|||||:      |:| :..:|     ::.|:..:.|..:
  Rat   234 KGKELSMFILLPME--IDGLKKLEEQLTADKLLEWTRAENMNMIDLY-----LSLPRFKVEEKYD 291

  Fly   411 LKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVH 475
            |...:|.||:...|.:.:.|.|             |.:|.|.               |:|..::|
  Rat   292 LPGPLQHMGMVDAFDSKKADFS-------------GMSSTQG---------------LMVSKVLH 328

  Fly   476 KVDFTVNEQGTEAAASSVTYLKKSGPDVL--FRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |....|||:||||||::...:..:...:.  |..|.||:.|::|:.|..:||:|.::.|
  Rat   329 KSFVEVNEEGTEAAAATGVEVSLTSAQITEDFNCDHPFLFLIKHNATNSILFFGRMSSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 110/440 (25%)
Serpinb3aXP_006249702.1 SERPIN 5..387 CDD:294093 112/447 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.