DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn28F

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster


Alignment Length:452 Identity:102/452 - (22%)
Similarity:196/452 - (43%) Gaps:97/452 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SNLPAAYSNGYVDLATSDRIANSVLNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYE 153
            :::...:::.:..|...:..||::::                 ||||:..:|::..:||:.::.:
  Fly    11 TSVSCRFADDFYQLLAKENAANNLIS-----------------SPLSVEIALSMAYMGARAKTAQ 58

  Fly   154 ELSTVFDIPDTSR-LHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHL 217
            |:..|..:||..: :..::..:|..|:  .||.::.                          :.|
  Fly    59 EMRNVLKLPDDKKEVAAKYKDLLSKLE--GREKVAT--------------------------LSL 95

  Fly   218 ANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIP 282
            ||.::....:.|.|.|.:::.:.:.::.:..|.. .|..|...:|.:|...|:..|:::::|:..
  Fly    96 ANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIV-DPNKASSIVNNWVDNQTRGKIKDLVSSNDM 159

  Fly   283 QTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKI 347
            ....:|:.||:|||..||..|....|:..||..:.:.:.|   |:||:...::....|.|||.||
  Fly   160 SKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQKSVP---VEMMSLFQSFRAAHDSELGAKI 221

  Fly   348 IGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLK 412
            |.||||.:..:|.|..|  ..|..|..|:|::...|     .::.:....:..||..:.....|.
  Fly   222 IELPYRNSSLSMLIFLP--DQVDGLSELEKKIVGFK-----PKLSKMDVTLRLPKFKIEFFAQLN 279

  Fly   413 TVMQRMGLGGIF--SAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVH 475
            .|:..||:...|  ||...||                  ::|             |::.|..::|
  Fly   280 KVLVAMGIQDAFEKSADFKDL------------------VEN-------------SNVHVKKVIH 313

  Fly   476 KVDFTVNEQGTE-AAASSVTYLKKSGP----DVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |....|||:|.| |||:::.:::.|.|    .::|..|.||..::|...|  :.|.|...:|
  Fly   314 KAFIEVNEEGAEAAAATALLFVRYSMPMPSSQMVFNADHPFAYVIRDRET--IYFQGHFVKP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 97/423 (23%)
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 101/444 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.