DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn42Da

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:431 Identity:111/431 - (25%)
Similarity:195/431 - (45%) Gaps:74/431 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RIANSVLN-FANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQ 170
            |:|...:| :..:.||  ..|:..::||.||....|:..|||:..:            .::|.:.
  Fly    44 RLALFSINVYGKLSGQ--KPGENIVFSPFSIQTCAAMARLGAENET------------ATQLDQG 94

  Fly   171 FGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRR 235
            .||...|   |.:.|.|..:.|..::.|..:|              :||.:|...||.|..::.:
  Fly    95 LGLASSD---PEQIAHSFHQVLAAYQDSQILR--------------IANKIFVMDGYQLRQEFDQ 142

  Fly   236 VIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQT-TRMILANALYFKAFW 299
            ::.:.:.|..|..||..: ..|...||.:|.|.|.:.|::::.:|:..: :|::|.||::||..|
  Fly   143 LLSKQFLSAAQSVDFSKN-VQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTW 206

  Fly   300 ETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQP 364
            :..|.:..||||.|:.:||.|   ::|.||:....:.|.:...|....:.|||:.:..:|.|:.|
  Fly   207 QHQFAKHLTRPDTFHLDGERT---VQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLP 268

  Fly   365 FKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQN 429
              ::...|.||:::|....:..:...:|.....:..|:......|.|..|.|::|:..:||    
  Fly   269 --NTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFS---- 327

  Fly   430 DLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVT 494
                        ..|..|..||:.|            .|.|..|:||....|||:||||||::..
  Fly   328 ------------DQAEFGKMLQSPE------------PLKVSAIIHKAFIEVNEEGTEAAAATGM 368

  Fly   495 YLKKS----GPD--VLFRGDTPFMVLVRHDPTKLVLFYGLI 529
            .:::.    .|:  :.|..|.||..::.|. ..|.||:|.:
  Fly   369 AVRRKRAIMSPEEPIEFFADHPFTYVLVHQ-KDLPLFWGSV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 108/423 (26%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 110/428 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.