DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn55B

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster


Alignment Length:421 Identity:105/421 - (24%)
Similarity:188/421 - (44%) Gaps:75/421 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FANILGQHLANG---KTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLH--EQFGLM 174
            |.:.|.|.|:.|   :..::||.||...:||...|::|.:.:|::        ..||  ..|   
  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIA--------KALHFVSNF--- 68

  Fly   175 LQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVE 239
                  |...|.:....|..:|.|:.:|              :||.|:.|.|..|.|.|:..|.|
  Fly    69 ------PPEVAQTFQFVLEKYRNSNLLR--------------VANKLYVQEGKQLKPAYQSAIKE 113

  Fly   240 VYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRMILANALYFKAFWETDF 303
            .|.|:.:..:|..:.|.|: .|||:|...|:..|..::::| ....||::|.|||:||..|...|
  Fly   114 QYHSEAESINFALNDAAAQ-AINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKF 177

  Fly   304 IESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSS 368
            .|..|..|.|:   .|.|..:::..|.....:.|....:|||..:.:||:.:..:|:::.|.:.:
  Fly   178 SEERTEEDIFW---VGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERT 239

  Fly   369 VRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSL 433
              .:.||.::|....:..:..::......|.|||..:..|:.|...::::|:..:|         
  Fly   240 --GIYALAEKLKTVNLVDLADKLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMF--------- 293

  Fly   434 IATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS--VTYL 496
              |::|..:|.|                 .:...:.|..::||....|||:||||||::  :...
  Fly   294 --TDQAEFSNLL-----------------ESPEGVFVSKVLHKATIEVNEEGTEAAAATGMIMMT 339

  Fly   497 KKSGPDVLFRGDTPFMVLVRHDPTKLVLFYG 527
            :.....:.|:.|.||:.::.:  .|.:||.|
  Fly   340 RMMTFPLQFQADRPFLYVIWN--KKNILFAG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 104/419 (25%)
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 105/421 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.