DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINC1

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens


Alignment Length:485 Identity:125/485 - (25%)
Similarity:200/485 - (41%) Gaps:112/485 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ATSDRI-----ANSVLNFANILGQHLANGKTQ----IYSPLSIVHSLALLLLGAKGRSYEELSTV 158
            ||:.|:     |||  .||....||||:.|..    ..|||||..:.|:..|||...:.::|..|
Human    75 ATNRRVWELSKANS--RFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEV 137

  Fly   159 FDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFT 223
            |.. ||             :.:.|.:.|..      :.|....|..|:|.:  :.::..||.||.
Human   138 FKF-DT-------------ISEKTSDQIHF------FFAKLNCRLYRKANK--SSKLVSANRLFG 180

  Fly   224 QTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRM 287
            ....|.|..|:.:...||.:.||..||:.:...:|..||.:|:..|:..|.::|.|: |.:.|.:
Human   181 DKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVL 245

  Fly   288 ILANALYFK-----------------------------------------AFWETDFIESATRPD 311
            :|.|.:|||                                         ..|::.|....||.:
Human   246 VLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKE 310

  Fly   312 NFY-PNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMAL 375
            .|| .:||...    ..||...|.:.|....| |.:::.||::|:..||.:|.|  ...:.|..:
Human   311 LFYKADGESCS----ASMMYQEGKFRYRRVAE-GTQVLELPFKGDDITMVLILP--KPEKSLAKV 368

  Fly   376 QKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEAT 440
            :|.||.:.::..:..:.....:|..|:..:.:..:||..:|.|||..:||..::.|..|...   
Human   369 EKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAE--- 430

  Fly   441 RTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYL--KKSGPD- 502
                                   .|.||.|.|..||....|||:|:|||||:...:  :...|: 
Human   431 -----------------------GRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNR 472

  Fly   503 VLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |.|:.:.||:|.:|..|...::|.|.:..|
Human   473 VTFKANRPFLVFIREVPLNTIIFMGRVANP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 118/465 (25%)
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 125/485 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.