DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn100A

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:427 Identity:84/427 - (19%)
Similarity:158/427 - (37%) Gaps:131/427 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRP----LTDWRASSAMRSNRRAQRP 210
            ||.:|.|.:.::.:...:.|:..| .:.:..|   |::||.|    |...:..:|:::   |.:.
  Fly   292 RSDQEESQIKNLEENETVQEEEKL-AKIMAAP---ALTAGEPEKVRLPLQKLENAVKT---AAKD 349

  Fly   211 GAHEVHLA-----------NG---LFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNI 261
            ||.|:.||           ||   ||.|...|              |.|......|..|.::   
  Fly   350 GADEIMLALESHLPSVSRVNGARSLFQQDDIT--------------SALSANSITGRSAGSK--- 397

  Fly   262 NAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFY--PNGEGTEPVM 324
                                   ::|:|.|.||::..|...|.:.....|.|:  .|    |..:
  Fly   398 -----------------------SKMLLFNGLYYRGSWANPFYQLRDGSDEFFFMTN----EDAV 435

  Fly   325 RVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSS-----VRELMALQKRLTADKI 384
            :..||...|.:...:..::..:::.|||..:...:.|:.|.::.     :.:|.      |:|.:
  Fly   436 KAPMMHARGKFQVADLPQVKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQ------TSDFL 494

  Fly   385 ESMISRMYRRAAL-VAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGN 448
              :..:.::...| ::.||..:.|:...:.::::|||..:||..:..|||::.:           
  Fly   495 --LAKKQFQMKELHISMPKFQVEETSRSEAMLKQMGLKKVFSRTEAQLSLLSED----------- 546

  Fly   449 SLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSGPDV---------- 503
                             .|:.||:||..|:..|:|.|:.|.:.|...::...|.|          
  Fly   547 -----------------PDVHVDEIVQFVNVRVDEGGSSANSLSAATMQARTPSVESTVLPVPEP 594

  Fly   504 --------LFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
                    .|..:.||...:.....:.||..|.|..|
  Fly   595 EPELPGVERFEVNRPFAYFIVDCQEQFVLASGKIYTP 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 81/420 (19%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 58/327 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.