DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb6e

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:436 Identity:108/436 - (24%)
Similarity:192/436 - (44%) Gaps:79/436 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ANSVLNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSR----LHE 169
            |...|....:||:.  :.|...:|..|:..||||:|:||.|.:..::|.|..:...|.    :.:
Mouse    61 ATFTLKLFRVLGED--SSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGGADVQQ 123

  Fly   170 QFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYR 234
            .|..:|.::.:            ||                ..|.:..||.:|:...:.:...::
Mouse   124 GFQSLLTEVNK------------TD----------------TGHMLRRANKIFSDNNFDIMESFK 160

  Fly   235 RVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIA-SDIPQTTRMILANALYFKAF 298
            ....::|..:::..||:|:|...|.:|||:||:.||:.|..::: ..:...||:||.||.|||..
Mouse   161 ESCYKLYRVEIEKLDFKGTPEQCRQHINAWVAKKTKDVIRELLSLYTVNSNTRLILVNATYFKGK 225

  Fly   299 WETDFIESATR--PDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYI 361
            ||..|.:..||  |.....|.:.|     ||||:....:..:...|:...|:.|||.....:|.|
Mouse   226 WEKQFNKEDTREMPFKVSKNEKKT-----VQMMSKKSTFKTYYAEEISTTIVFLPYTDKELSMII 285

  Fly   362 IQPFKSSVRELMALQKRLTADKI--ESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIF 424
            :.|.:..  ||..::.:::..|:  .:.:.:|......|..|:..|..:.::|.|:.::|:...|
Mouse   286 MLPDEQV--ELSMVENQISYKKLIQWTRLVKMEEEEVQVFLPRFKLEATYDMKDVLCKLGMTDAF 348

  Fly   425 SAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAA 489
            ...:.|.|.|:                            ::..|.:.::|||....|||:|||||
Mouse   349 EESRADFSGIS----------------------------SKKGLFLSNVVHKSFVEVNEEGTEAA 385

  Fly   490 ASSVTYLKKSGPDVLFR---GDTPFMVLVRHDPTKLVLFYGLINEP 532
            .:  |.:...|..:..|   .|.||:.|::.|.:|.:||.|..:.|
Mouse   386 VA--TEIVTVGSPLTQRCLIADRPFLFLIQGDKSKEILFLGRFSSP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 105/427 (25%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 107/434 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.