DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn88Eb

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:471 Identity:117/471 - (24%)
Similarity:193/471 - (40%) Gaps:102/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VDLATSDRIANSVLN-FANIL-GQH-----LANGKTQIY-------SPLSIVHSLALLLLGAKGR 150
            |.:|..|:...|.|| |:.|. |:.     |.....:||       ||.|..::|.|....:..:
  Fly    15 VTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQ 79

  Fly   151 SYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEV 215
            :..||:...::  ...|::|..|:...|.|...|        ..||.|..             |:
  Fly    80 TERELAQALNL--GWALNKQQVLVSYTLAQRQDE--------FRWRQSPM-------------EL 121

  Fly   216 HLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIAS- 279
            ..||.:|......::..:..::   |.:..:: ||:..|.|....||.::|..|.|.|.::::| 
  Fly   122 SSANRIFVDRTINVSNKFNTLL---YGATKEL-DFKNDPETGLKEINDWIADKTHNQIRDMLSSE 182

  Fly   280 DIPQTTRMILANALYFKAFWETDF--IESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHE 342
            :|...|.::||||.|.|..|.:.|  .|:|.:|  |:.|....|   .|.||...||:....|..
  Fly   183 EITPHTMLVLANAAYMKGQWLSQFKVEETALKP--FFINEREQE---MVYMMHKTGAFKMTIDEG 242

  Fly   343 LGCKIIGLPYR-------GNLST--------MYIIQPFKSSVRELMALQKRLTADKIESMISRMY 392
            |..:||.||||       .::||        |.||.|..:.: .|..:..||.||.::....|..
  Fly   243 LQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKI-SLNRVISRLNADSVKKWFERAL 306

  Fly   393 RRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQR 457
            .:...::.||....:.:.|..::..||:..:|:                               |
  Fly   307 PQKIELSLPKFQFEQRLELTPILSLMGVNTMFT-------------------------------R 340

  Fly   458 RAGTGGARSD---LVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSG--PD-VLFRGDTPFMVLVR 516
            .|..|...:|   ||:||..|.....|:|.|:.|||:::..:.:|.  || ..|..:.||:.|:.
  Fly   341 NATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIY 405

  Fly   517 HDPTKLVLFYGLINEP 532
            .:....:||.|:.::|
  Fly   406 DEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 112/453 (25%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 108/444 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.