DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn85F

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:249 Identity:50/249 - (20%)
Similarity:83/249 - (33%) Gaps:87/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PPAVPLQSPGLVNGLGNQNDPALNRISGTSVKPSNLPAAYSNGYVDLATSDRIANSVLNFANILG 120
            ||..||             |.....::...:.|:.:       .||| |:| :.:.:|::.:|| 
  Fly    43 PPLTPL-------------DHLPQVLAAKELTPAEV-------MVDL-TND-LTHRLLHYHSIL- 84

  Fly   121 QHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREA 185
                |.....:||.::|..|..|..|:.|.:.|||..|..:|                       
  Fly    85 ----NRNNFAFSPTALVSVLVALFEGSAGNTAEELRHVLQLP----------------------- 122

  Fly   186 ISAGRPLTDWRASSAMRSNRRAQRPGAHEVHL------------ANGLFTQTG-YTLNPDYRRVI 237
                             :||...|.|..::|.            ..||....| .|:..|:..|:
  Fly   123 -----------------NNRDVTRVGYRDIHRRLRTYFFGSDNPLKGLSLNKGNVTVLKDFETVL 170

  Fly   238 VEVYASDLQIQDFEGSPATARYN---INAYVAQHT---KNHIENIIASDIPQTT 285
            : .|..||.:.....:||....:   :|..:|.:|   :...|...:.|...||
  Fly   171 M-FYGYDLSVDMLSSTPANLTSDAELVNTTMASNTTTMEMDAETTTSKDAESTT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 39/194 (20%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093 30/156 (19%)
SERPIN <450..634 CDD:294093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.