DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb3d

DIOPT Version :10

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_958764.1 Gene:Serpinb3d / 394252 MGIID:2683295 Length:387 Species:Mus musculus


Alignment Length:80 Identity:28/80 - (35%)
Similarity:34/80 - (42%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MKNER--EPL-LGHA-----ADGGSNGSGLDVAEHQRLLARPDLRSSPENMIVDPSNDTDSLVSK 73
            :|.||  .|. |.|:     |.|||.|.||.....:..|||.|.|   ..:...|::.|.||.|.
Mouse   708 VKKERLGRPFSLYHSSSSSHAGGGSGGGGLFNVGRRLALARGDNR---REVYASPNSQTRSLDSP 769

  Fly    74 EDPTYGSSSGEPYEP 88
            ..|. .||...|..|
Mouse   770 PPPP-PSSPAPPLPP 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 serpin28D-like_insects 111..532 CDD:381061
Serpinb3dNP_958764.1 serpin 1..387 CDD:476815
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.