DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb1c

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006516771.1 Gene:Serpinb1c / 380839 MGIID:2445363 Length:408 Species:Mus musculus


Alignment Length:472 Identity:128/472 - (27%)
Similarity:213/472 - (45%) Gaps:83/472 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GLVNGLGNQNDPALNRISGTSVKPSNLPAAYSNGYVDLATSDRIANSVLNFANILGQHLANGKTQ 129
            ||.:.:||.:.|::              ||::.|  .|::::.:  ..|...:.|.:....|.| 
Mouse    16 GLADIVGNVDPPSV--------------AAFTMG--QLSSANNL--FALELFHTLNESNPTGNT- 61

  Fly   130 IYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTD 194
            |:||:||..:||::.|||:|.:..:||..........:|.||       |..|.|.         
Mouse    62 IFSPVSISSALAMVYLGARGSTAAQLSKTLHFDSAEDIHSQF-------QSLTAEV--------- 110

  Fly   195 WRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARY 259
                        ::|..:|.:.|||.|:.:..|...|:|...|.:.|::||.:.||:.:...||.
Mouse   111 ------------SKRGASHTLKLANRLYGEKTYNFLPEYLASIQKTYSADLALVDFQHASEDARK 163

  Fly   260 NINAYVAQHTKNHIENIIASDIPQT-TRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPV 323
            .||.:|...|:..|:.:.|..:..: |:::|.||.|||..|:..|:...|....|..:.:.|:  
Mouse   164 EINQWVKGQTEEKIQELFAVGVVDSMTKLVLVNATYFKGMWQKKFMARDTTDAPFRLSKKVTK-- 226

  Fly   324 MRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQP--FKSSVRELMALQKRLTADKIES 386
             .|:||......|:....:|.||::.:||:|...:|.|:.|  .:.....|..::|:||.:|::.
Mouse   227 -TVKMMYLKNNLPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDETTGLEEIEKQLTLEKLQE 290

  Fly   387 MISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQ 451
             ...:......|..||..:.||..|.:.:.::|:..:||:.:.|||                   
Mouse   291 -CENLQNIDVCVKLPKFKMEESYILNSNLGQLGVQDLFSSSKADLS------------------- 335

  Fly   452 NLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEA-AASSVTYLKKSGPDVLFRGDTPFMVLV 515
                    |..|:| ||.:..||||....|||:|||. ||...|.:......:.|..|.||:..:
Mouse   336 --------GMSGSR-DLFISKIVHKSYVEVNEEGTETDAAMPGTVVGCCLMPMEFTVDHPFLFFI 391

  Fly   516 RHDPTKLVLFYGLINEP 532
            ||:||..|||.|.:..|
Mouse   392 RHNPTAHVLFLGRVCSP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 117/419 (28%)
Serpinb1cXP_006516771.1 serpinB1_LEI 34..408 CDD:381028 120/438 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.