DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and AT1G62160

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:203 Identity:50/203 - (24%)
Similarity:72/203 - (35%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 GCKIIGLPYR-GNLST-----MYIIQPFKSSVRELMALQKRLTADK--IESMISRMYRRAALVAF 400
            |.|::.|||| |..:|     ||...|.|..  ||..|.||:|:..  ::|...|..........
plant    69 GFKVLRLPYRQGRDNTNRNFSMYFYLPDKKG--ELDDLLKRMTSTPGFLDSHTPRERVEVDEFRI 131

  Fly   401 PKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGAR 465
            ||..:.......:|         ||..:.|:|                                 
plant   132 PKFKIEFGFEASSV---------FSDFEIDVS--------------------------------- 154

  Fly   466 SDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSGPDVL----FRGDTPFMVLVRHDPTKLVLFY 526
                   ...|....::|:||||||::.....:.|...:    |..|.||:.|:|.:.|..|||.
plant   155 -------FYQKALIEIDEEGTEAAAATAFVDNEDGCGFVETLDFVADHPFLFLIREEQTGTVLFA 212

  Fly   527 GLINEPPA 534
            |.|.:|.|
plant   213 GQIFDPSA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 46/194 (24%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 48/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.