DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn53F

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:224 Identity:56/224 - (25%)
Similarity:85/224 - (37%) Gaps:60/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 ILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPY 352
            :|.||::|...||..|...||.|..|..|  .|:.|| :.||        |||.:....|:    
  Fly   167 LLVNAIFFNLSWERTFNPEATYPREFRVN--ATKSVM-IPMM--------HEDSKFAFGIL---- 216

  Fly   353 RGNLSTMYIIQPFK-SSVRELM----------ALQKRLTADKIESMISRMYRRAALVAFPKMHLT 406
             |||....::.||. ..:|.|:          |||.:|.|..|.|:...:......|..||..:.
  Fly   217 -GNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIH 280

  Fly   407 ESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVD 471
            ..:.|....::||:..||...::..:|:..|...|                            :|
  Fly   281 SDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFR----------------------------ID 317

  Fly   472 DIVHKVDFTVNEQG-----TEAAASSVTY 495
            .::|.|.|...|||     |:....|:|:
  Fly   318 GVIHVVTFEFQEQGIGTPSTDVGNGSLTH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 56/224 (25%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 56/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.