DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb6b

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:441 Identity:108/441 - (24%)
Similarity:187/441 - (42%) Gaps:88/441 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDL 178
            |....||:.  :.|..::|||||...||::.:||||.:..::.....:...|      |...:|:
  Rat    14 NLLKTLGED--SSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSLDKCS------GRGSRDV 70

  Fly   179 QQPTREAISAGRPLTDWRASSAMRSNRRAQRPGA-HEVHLANGLFTQTGYTLNPDYRRVIVEVYA 242
            .|..:..::                  :..:.|. :.:..||.||.:..:.:...::....:.|.
  Rat    71 HQGFQSLLA------------------KVNKTGTQYLLKTANRLFGEKTFDILASFKDACRKFYE 117

  Fly   243 SDLQIQDFEGSPATARYNINAYVAQHT------------KNHIENIIASDIPQTTRMILANALYF 295
            ::::..||:|:|..:|.:||.:||:.|            |...|.:.:..:...|.::|.||:||
  Rat   118 AEMEELDFKGAPEQSRQHINTWVAKKTEGQSISLNWNSQKKITELLSSGSVNANTPLVLVNAIYF 182

  Fly   296 KAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMY 360
            |..|:..|.:..|:...|.......:|   |:||.....:......|:...|:.|||.||...|.
  Rat   183 KGNWKKQFNKEDTQEMPFKVTKNEEKP---VKMMFKKSTFKMTYVEEISTTILLLPYVGNELNMI 244

  Fly   361 IIQPFKSSVRELMALQKRLTADK-IE-SMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGI 423
            |:.|.:..  ||..::|.:|..| || :.:.:|..|...|..||..|.|:.::|.|:.|:|:...
  Rat   245 IMLPDEHI--ELRMVEKEITYKKFIEWTSLDKMEEREVEVFLPKFKLEENHDMKDVLHRLGMTDA 307

  Fly   424 FSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEA 488
            |.....|.|.||:.|.                            |.:..::||....|||:||||
  Rat   308 FEQGMADFSGIASKEG----------------------------LFLSKVIHKSFVEVNEEGTEA 344

  Fly   489 AASSVTYLKKSGPDVLFR-------GDTPFMVLVRHDPTKLVLFYGLINEP 532
            ||::..       :|.||       .:.||:..::|..|..::|.|..:.|
  Rat   345 AAATAA-------NVTFRCMVPYFCANHPFLFFIQHSRTNGIVFCGRFSSP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 106/434 (24%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 107/439 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.