DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Spn42Dc

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster


Alignment Length:451 Identity:106/451 - (23%)
Similarity:184/451 - (40%) Gaps:86/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 YSNGYVDLATSDRIANSVLNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVF 159
            ::...:|:.|.|.:..|       ...|:    ..::||.|:..:|.|..:||.|.:.|||....
  Fly    11 FARNLIDVITKDALQQS-------KDPHI----NTVFSPASVQSALTLAFMGASGSTAEELRNGL 64

  Fly   160 DIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQ 224
            .:....|.|               .|::.|.   .||.|    .|...:.|....|   |.|:..
  Fly    65 QLGPGDRHH---------------IALNFGE---FWRTS----CNYGDRGPVLKSV---NRLYVN 104

  Fly   225 TGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRMI 288
            ....|..::..:.|:.:.|..:...|..|....:. ||.:|.|.|::.|.|::.|| :...|..:
  Fly   105 DSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL-INDWVEQETEHKITNLLQSDAVNNETSAL 168

  Fly   289 LANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYR 353
            |.|.||||..|:..|:...|..|:|:.:   .:..::|.||.....:.:.|..:|..:.:.|||.
  Fly   169 LINVLYFKGKWQKPFMPETTSIDHFHVD---RDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYD 230

  Fly   354 GNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRM 418
            .:...|.|:.|  :.|..|..|:::|....:..:.:.:..:...:..|:|.:...|:||.|:.::
  Fly   231 YSNIHMLILLP--NEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQL 293

  Fly   419 GLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNE 483
            |:..:||           ::|.........|.|.:.|.|..|        .:|         |||
  Fly   294 GITEVFS-----------DKAKLDGLFTSQSGQKISAARHRG--------YID---------VNE 330

  Fly   484 QGTEAAASSVTYL--------KKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEPPAAA 536
            .|:||||.|...:        ||     ||:.|.||:..:|:  .:.|.|.|..:.|.:.:
  Fly   331 AGSEAAAVSFMKIVPMMLNMNKK-----LFKADHPFVFYIRN--PQAVFFAGRFSNPKSGS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 101/424 (24%)
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 105/442 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.