DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpine3

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:414 Identity:83/414 - (20%)
Similarity:160/414 - (38%) Gaps:92/414 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQP-TREAISA 188
            ||...:.||.|:..||.:|..||:|.:..:|:               |.:...:|.| .:|.:  
Mouse    48 NGTNFVISPASVSLSLEILQFGARGNTGWQLA---------------GALGYTVQDPRVKEFL-- 95

  Fly   189 GRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDF--- 250
                      .|:.:.|.....|. .:.||..||.|||.:|:|.:...:.....|.|:..||   
Mouse    96 ----------HAVYTTRHNSSQGV-GMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAADFSEP 149

  Fly   251 -----EGSPATARYNINAYVAQHTKNHIENIIASDIP-------QTTRMILANALYFKAFWETDF 303
                 |.|..|:|.:...              ..|.|       .:|::.:.:.:.|::.|:..|
Mouse   150 NSTTTEASKVTSRQSTGE--------------GPDSPLWGRADALSTQLSIMSTMTFQSTWQKRF 200

  Fly   304 IESATRPDNF-YPNGEGTE-PVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFK 366
             ....:|..| :.:|...: |.|......:.|.:.....||:.  ::.|.|.|.::::.::.| :
Mouse   201 -SVVLQPLPFTHAHGLVLQVPAMHQVAEVSYGQFQDAAGHEIA--VLELLYLGRVASLLLVLP-Q 261

  Fly   367 SSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDL 431
            .....|..::..|||..:....:|:.|....|..|:..:....::|::::..|:..:|..::.:|
Mouse   262 DKGTPLDHIEPHLTARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKANL 326

  Fly   432 SLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYL 496
            .                           |..| :....|..:.||....::|:||.::|::...|
Mouse   327 K---------------------------GISG-QDGFYVSQLTHKAKMELSEEGTRSSAATAVLL 363

  Fly   497 KKSGPDVLFRGDTPFMVLVRHDPT 520
            .:......|:.|.||:.|:|...|
Mouse   364 LRRSRTSAFKADRPFIFLLREHST 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 83/414 (20%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 83/414 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.