DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb1b

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:434 Identity:121/434 - (27%)
Similarity:198/434 - (45%) Gaps:70/434 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ANSV--LNFANILGQHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQF 171
            |||:  |...:.|.:....|  .|:||.||..:||::.|||||.|         .|.:.||.|.|
  Rat     7 ANSLFALELFHTLSESSPTG--NIFSPFSISSALAMVFLGAKGSS---------APSSLRLAETF 60

  Fly   172 GL-MLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGA-HEVHLANGLFTQTGYTLNPDYR 234
            .. .::|:.                  |.....|...::.|| |.:.:||.|:.:..|...|::.
  Rat    61 HFDSVEDIH------------------SRFQSLNAEMRKHGASHTLKVANRLYGEKTYNFLPEFL 107

  Fly   235 RVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRMILANALYFKAF 298
            ....::|.:||...||:.:...||..||.:|...|:..|..::|.. :..||:::|.||:|||..
  Rat   108 ASTQKMYGADLAPVDFQHASEDARKEINKWVKGQTEGKIPELLAGGVVNSTTKLVLVNAIYFKGI 172

  Fly   299 WETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQ 363
            |:..|:...|....|..|.:.|:   .|:||.....:|:....:|.||::.:||:|...:|.|:.
  Rat   173 WQEKFLTRHTTDAPFRLNKKDTK---MVKMMYQKEKFPFGYIPDLKCKVLEMPYQGGELSMVILL 234

  Fly   364 P--FKSSVRELMALQKRLTADKIESMI--SRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIF 424
            |  .:.....|..::::||.:|:....  ..:......|..||..:.||..|.:.:.|:||..:|
  Rat   235 PEDIEDESTGLQKIEEQLTLEKLYEWTKHENLKEIDVHVNLPKFKIEESYILNSNLGRLGLQDLF 299

  Fly   425 SAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAA 489
            |:.:.|||                           |...:| |:.:..||||....|||:|||||
  Rat   300 SSSKADLS---------------------------GMSESR-DIFISKIVHKSFVEVNEEGTEAA 336

  Fly   490 ASSVTYLKKSGPDV-LFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            |::...::.....: .|..|.||:..:||:||..:||:|.:..|
  Rat   337 AATAGLVEYCLVSIEAFIVDHPFLFFIRHNPTANMLFFGRVCSP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 117/425 (28%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 120/432 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.