DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb13

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:457 Identity:98/457 - (21%)
Similarity:197/457 - (43%) Gaps:99/457 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DRIANSVLNFANILGQHLANGKTQ----IYSPLSIVHSLALLLLGAKGRSYEELSTVF------- 159
            |.::.:..:|...|.:.|  .||.    .:|||.|..::.::|||.:|.:..||..|.       
  Rat     2 DSLSTATTHFLFDLFKEL--NKTSDGNVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTG 64

  Fly   160 ---------DIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEV 215
                     :|..|..:|.||..:|.::.:||::                            :::
  Rat    65 SSRLKSEEKEIEKTEEIHHQFQKLLTEISKPTKD----------------------------YDL 101

  Fly   216 HLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENII-AS 279
            .::|.|:.:..|.....|...:.:.|.:.|:..||..:...:|..||::|...|...::::. ..
  Rat   102 IISNRLYGERTYLFLQKYIDYVEKYYHASLEPVDFVNAADESRKKINSWVESQTNEKVKDLFPEG 166

  Fly   280 DIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELG 344
            .:..:|:::|.|.:|||..|:.:|.:..|:.::|:.|...::|   |||||...::.:....:|.
  Rat   167 SLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWLNKNISKP---VQMMAQCSSFSFTLLEDLQ 228

  Fly   345 CKIIGLPYRGNLSTMYIIQPFKSSVRELMALQK---RLTADKIESMIS--RMYRRAALVAFPKMH 404
            .||:|:||:.:..:|:::.|     .::..|:|   :|:.:|:....|  ::.:|...:..|::.
  Rat   229 AKIVGIPYKNSDFSMFVLLP-----NDIDGLEKIIDKLSPEKLVEWTSPGQLKQRKVDLRLPRLK 288

  Fly   405 LTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGG--ARSD 467
            :.|:.:|:..::.:|:...||                               ..|...|  |.|.
  Rat   289 VEETYDLQPTLEAVGIHSAFS-------------------------------EHADYSGMSAHSG 322

  Fly   468 LVVDDIVHKVDFTVNEQGTEAAASSVTYLK--KSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLIN 530
            |...:.:|:....|.|:|.||.|.:....|  .:....|...:.||:..|||..:..:||:|..:
  Rat   323 LQTQNFLHRSFLVVTEEGVEATAGTGVGFKVLSAASCELVHCNHPFLFFVRHRESDSILFFGRFS 387

  Fly   531 EP 532
            .|
  Rat   388 SP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 95/445 (21%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 96/453 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.