DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina6

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:428 Identity:96/428 - (22%)
Similarity:178/428 - (41%) Gaps:85/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SNGYVDLATSDRIANSVLNFANILGQHLA---NGKTQIYSPLSIVHSLALLLLG-AKGRSYEELS 156
            ||.:..||.::      ::||..|.|.|.   ..|..:.||:||..:||::.|| |:.:|.:.|.
  Rat    28 SNSHRGLAPTN------VDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSAQTQSLQSLG 86

  Fly   157 TVFDIPDTS--RLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLAN 219
              |::.:||  .:|:.|..:...|:|                :.:.:            |:::.|
  Rat    87 --FNLTETSEAEIHQSFQYLNYLLKQ----------------SDTGL------------EMNMGN 121

  Fly   220 GLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQT 284
            .:|......|...:...:.:.|.|:....||| ....|...||.:|...|:..||::. ||:...
  Rat   122 AMFLLQKLKLKDSFLADVKQYYESEALAIDFE-DWTKASQQINQHVKDKTQGKIEHVF-SDLDSP 184

  Fly   285 TRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIG 349
            ...||.|.::.:..||..|....||.::||.|...|   ::|.||...|:..|..|....|::|.
  Rat   185 ASFILVNYIFLRGIWELPFSPENTREEDFYVNETST---VKVPMMVQSGSIGYFRDSVFPCQLIQ 246

  Fly   350 LPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTV 414
            :.|.|| .|.:.|.|.:..:..::|...|.|.|:...:   |..|...:..||..::::.:||.:
  Rat   247 MDYVGN-GTAFFILPDQGQMDTVIAALSRDTIDRWGKL---MTPRQVNLYIPKFSISDTYDLKDM 307

  Fly   415 MQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDF 479
            ::.:.:..:.:. |:|.|                             |..:...:...:|||...
  Rat   308 LEDLNIKDLLTN-QSDFS-----------------------------GNTKDVPLTLTMVHKAML 342

  Fly   480 TVNEQGT--EAAASSVTYLKKSGPDVLFRGDTPFMVLV 515
            .::|...  .:...:..:|:....|:.|  :.||::|:
  Rat   343 QLDEGNVLPNSTNGAPLHLRSEPLDIKF--NKPFILLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 92/413 (22%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 92/419 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.