DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinf1

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:482 Identity:108/482 - (22%)
Similarity:189/482 - (39%) Gaps:113/482 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NQNDPALNRISGTSVK--------PSN-LPAAYSNGYVDLATSDRIANSVLNFANILGQHLANGK 127
            :|:.||.:......|:        |.| |.||.||...||.   |:.:..::..|||        
  Rat    26 SQDSPAPDSTGEPVVEEDDPFFKAPVNKLAAAVSNFGYDLY---RLRSGAVSTGNIL-------- 79

  Fly   128 TQIYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGR 190
               .||||:..:|:.|.|||:.|:...:  :..:|:.:...:|..:..:|..:..|.:...||.|
  Rat    80 ---LSPLSVATALSALSLGAEQRTESVIHRALYYDLINNPDIHSTYKELLASVTAPEKNFKSASR 141

  Fly   191 PLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPA 255
            .:.:.:    :|.......|            .:..|...|   |::.             |:|.
  Rat   142 IVFERK----LRVKSSFVAP------------LEKSYGTRP---RILT-------------GNPR 174

  Fly   256 TARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGT 320
            .....||.:|....|..|.. ...::|....::|....|||..|.|.|....|...:|:.:.:.|
  Rat   175 IDLQEINNWVQAQMKGKIAR-STREMPSALSILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRT 238

  Fly   321 EPVMRVQMMATGGA-YPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKI 384
               :||.||:...| ..|..|.:|.|||..||..|::|.::.: |. :..:.|..:::.||::.:
  Rat   239 ---VRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFL-PL-TVTQNLTMIEESLTSEFV 298

  Fly   385 ESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNS 449
            ..:...:....|::..||:.|:...::...:|.|.|..:|.:  .|.|.|               
  Rat   299 HDIDRELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLFES--PDFSKI--------------- 346

  Fly   450 LQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSGPDVL---------F 505
                       ||   ..:.:..:.|:..|..||:|   |.:|      |.||:.         :
  Rat   347 -----------TG---KPVKLTQVEHRAAFEWNEEG---AGTS------SNPDLQPVRLTFPLDY 388

  Fly   506 RGDTPFMVLVRHDPTKLVLFYGLINEP 532
            ..:.||:.::|...|..:||.|.|.:|
  Rat   389 HLNRPFIFVLRDTDTGALLFIGRILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 91/427 (21%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 104/466 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.