DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina3c

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:416 Identity:113/416 - (27%)
Similarity:190/416 - (45%) Gaps:77/416 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KTQIYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDTS--RLHEQFGLMLQDLQQPTREAIS 187
            |..::|||||..:||:|.||||..:.||:  ...|::.:.:  .:|:.||.:||.|.||..:|  
  Rat    67 KNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGFGHLLQRLSQPEDQA-- 129

  Fly   188 AGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEG 252
                                      |::..:.||......:..:::.....:|.::..:.||:.
  Rat   130 --------------------------EINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQ 168

  Fly   253 SPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNG 317
            .....:: ||.||:..|:..|..:. ||:.:.|.|:|.|.|.||..|:..|..:.|....||.:.
  Rat   169 CNEAKKF-INDYVSNQTQGKIAELF-SDLDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDE 231

  Fly   318 EGT--EPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVREL-MALQKRL 379
            :.:  .|:|:::.:.|    ||..|.||.|.::.|.|.||.|.::|: |.:..:::: .:||...
  Rat   232 KRSVKVPMMKIKDLTT----PYVRDEELSCSVLELKYTGNASALFIL-PDQGKMQQVESSLQPET 291

  Fly   380 TADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNA 444
            .....:|:..|:...   :..||..::...||:.|:..:|:..|||. |.|||            
  Rat   292 LKKWKDSLRPRIISE---LRMPKFSISTDYNLEEVLPELGIRKIFSQ-QADLS------------ 340

  Fly   445 LGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTE-AAASSVTYLKKSGPDV--LFR 506
                        |..||    .:|.|..:|||....|:|.||| |||::||...||.|..  |..
  Rat   341 ------------RITGT----KNLHVSQVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLN 389

  Fly   507 GDTPFMVLVRHDPTKLVLFYGLINEP 532
            .:.|||:::..:..:.|.|.|.:..|
  Rat   390 FNRPFMLVITDNNGQSVFFMGKVTNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 111/409 (27%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 112/414 (27%)
RCL 365..392 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.