DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb10

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:386 Identity:81/386 - (20%)
Similarity:151/386 - (39%) Gaps:61/386 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LLLLGAKGRSYEELSTVFDI---------PDTSRLHE------QFGLMLQDLQQPTREAISAGRP 191
            ::.||.||.:.::::.|...         ||:.:..:      :|..:..|.|....|.:..|  
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPG-- 63

  Fly   192 LTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPAT 256
                               .::.:..||.::.:..|..:..|...:...:.::.|..:|..:...
Mouse    64 -------------------NSYVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQ 109

  Fly   257 ARYNINAYVAQHTKNHIENIIASDIPQT-TRMILANALYFKAFWETDFIESATRPDNFYPNGEGT 320
            .|..||::|...|...|.|::..|...| |:|:|.||||||..||..|...:|....|..|...:
Mouse   110 IRKEINSWVGSQTGGKIPNLLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTS 174

  Fly   321 EPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIE 385
            :||..:.|..:...:...|...:|   :.|.|:....::.::.|  .::..|..|::.:|.:|::
Mouse   175 KPVQMMSMKQSLQVFHIEELQTIG---LQLHYQNRDLSLLLLLP--EAIDGLEQLERAITYEKLD 234

  Fly   386 SMIS--RMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGN 448
            ...|  .|......:..||..:.||.:||:.::.....|.:|...|:..|.....||..|...|:
Mouse   235 KWTSADMMDTYEVQLYLPKFKMEESYDLKSALRGQKFSGPYSKENNEDHLPHIYSATLDNQQNGH 299

  Fly   449 SLQNL----EAQRRAGTGGARSD-------LVVDDIVHKVDFT------VNEQGTEAAASS 492
            .:...    ..:|:..|...|.|       .|||.:.:....|      :|....::..||
Mouse   300 PVSPRHVFGNGKRKHSTVSGRCDCKSLIQTFVVDIVENSALATSLLISPINSSCADSGTSS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 81/386 (21%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 63/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.