DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina3n

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:419 Identity:119/419 - (28%)
Similarity:189/419 - (45%) Gaps:83/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KTQIYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDTSR--LHEQFGLMLQDLQQPTREA-I 186
            |..::|||||..:||::.|||||.:.||:  ...|::.:||.  :|:.||.:||.|.||..:. |
Mouse    69 KNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQI 133

  Fly   187 SAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFE 251
            |.|                             :.||.:....:..:::.....:|.::....||:
Mouse   134 STG-----------------------------SALFIEKRQQILTEFQEKARALYQAEAFTADFQ 169

  Fly   252 GSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPN 316
             .|..|:..||.||.:.|:..|:.:: ||:.:.|.|:|.|.:||||.|:..|....|....||..
Mouse   170 -QPRQAKKLINDYVRKQTQGMIKELV-SDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAG 232

  Fly   317 GEG--TEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMA-LQKR 378
            ...  ..|:|.::.:.|    ||..|.||.|.::.|.|.||.|.|:|: |.:..::::.| ||..
Mouse   233 KRRPVIVPMMSMEDLTT----PYFRDEELFCTVVELKYTGNASAMFIL-PDQGKMQQVEASLQPE 292

  Fly   379 LTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTN 443
            .......|:..||.....|   ||..::...:|:.|:.::|:..:|| .|.|||.|         
Mouse   293 TLRKWKNSLKPRMIDELHL---PKFSISTDYSLEDVLSKLGIREVFS-TQADLSAI--------- 344

  Fly   444 ALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS-VTYLKKSGP----DV 503
                           .||    .||.|..:|||....|.|.||||||:: |.::..|..    .|
Mouse   345 ---------------TGT----KDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTV 390

  Fly   504 LFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            .|  :.||::::....|::..|...|..|
Mouse   391 YF--NRPFLIMIFDTETEIAPFIAKIANP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 117/412 (28%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 119/419 (28%)
RCL 367..392 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.