DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina3g

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:422 Identity:112/422 - (26%)
Similarity:183/422 - (43%) Gaps:95/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDTSR--LHEQFGLMLQDLQQPTREA-ISAG 189
            ::||.||..:||||.||||..:.:|:  ...|::.:|..  :|:.|..:|..|.||..:. ||.|
Mouse    62 VFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTETPEPDIHQGFRYLLDLLSQPGNQVQISTG 126

  Fly   190 RPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSP 254
                                         :.||.:....:..:::.....:|.::....||: .|
Mouse   127 -----------------------------SALFIEKHLQILAEFKEKARALYQAEAFTADFQ-QP 161

  Fly   255 ATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEG 319
            ..|...||.||:.||:..|:.:| |.:.::..|:|.|.:|||..|:..|..:.|....||.:.:.
Mouse   162 LKATKLINDYVSNHTQGKIKQLI-SGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKR 225

  Fly   320 TEPVMRVQMMATGGAY---PYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMA-LQKRLT 380
            :   :.|.||.||  |   ||..|.||.|.::.|.|.||.|.|:|: |.:..::::.| ||....
Mouse   226 S---VIVSMMKTG--YLTTPYFRDEELSCTVVELKYTGNASAMFIL-PDQGRMQQVEASLQPETL 284

  Fly   381 ADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNAL 445
            .....|:..||.....|   ||..::...:|:.::..:|:..:|| .|.|||.|           
Mouse   285 RKWKNSLKPRMIHELRL---PKFSISTDYSLEHILPELGIREVFS-TQADLSAI----------- 334

  Fly   446 GGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS----------VTYLKKSG 500
                         .||    .||.|..:|||....|.|:||||||::          ..:|    
Mouse   335 -------------TGT----KDLRVSQVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDFL---- 378

  Fly   501 PDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
             ::.|  :.||::::......:.||...:..|
Mouse   379 -EIFF--NRPFLMIISDTKAHIALFMAKVTNP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 111/415 (27%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 111/420 (26%)
RCL 357..382 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.