DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpinb9c

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:455 Identity:116/455 - (25%)
Similarity:193/455 - (42%) Gaps:99/455 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RIANSVLNFANILGQHLANG----------------KTQIYSPLSIVHSLALLLLGAKGRSYEEL 155
            |:.|....|.||:  :.|||                |...|||::|..:||:.|||.||.:..::
Mouse    19 RVQNGEPPFLNIV--YEANGTFAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQI 81

  Fly   156 STVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANG 220
            |....:.....:|:.|..:|..|::|||:                            :...:||.
Mouse    82 SEAIGLNTAIDIHQSFLWILNILKKPTRK----------------------------YTFRMANR 118

  Fly   221 LFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIAS-DIPQT 284
            ||.:......|.::...::.|..:::...|..:|..||.:||.:|.::||..|..:::| .:...
Mouse   119 LFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEARNHINTWVCKNTKGKIPELLSSGSVDSE 183

  Fly   285 TRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHED-------HE 342
            ||::|.||||||..|...|...:||...|..|.:...|   ||||       :.||       :|
Mouse   184 TRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERP---VQMM-------FQEDMFKLAYVNE 238

  Fly   343 LGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRA--ALVAFPKMHL 405
            :..:::.|||:|...::.::.|  ....||..::..||.:|:.:.....|.:.  .||..||..|
Mouse   239 VQVQVLVLPYKGKELSLVVLLP--DDGVELSKVEGNLTFEKLSAWTKPDYLKTTKVLVFLPKFKL 301

  Fly   406 TESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVV 470
            .:..:::::.|.:|:|.||...:.|||.::....                            |.|
Mouse   302 EDYYDMESIFQDLGVGDIFQGGKADLSEMSPERG----------------------------LCV 338

  Fly   471 DDIVHKVDFTVNEQGTEAAASSV--TYLKKSGPD-VLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            ...:.|....|||:||||.|::.  |.......| ..|..|.||:..:||:.|..:||.|..:.|
Mouse   339 SKFIQKCVVEVNEEGTEATAATADDTVCSAETHDGQTFCADHPFLFFIRHNKTNSILFCGRFSFP 403

  Fly   533  532
            Mouse   404  403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 112/444 (25%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 112/444 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.