DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina1d

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_033272.1 Gene:Serpina1d / 20703 MGIID:891968 Length:413 Species:Mus musculus


Alignment Length:438 Identity:109/438 - (24%)
Similarity:186/438 - (42%) Gaps:78/438 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SDRIANSVLNFANILGQ---HLANGKTQIYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDT 164
            |..||.::.:||..|.:   |.:|.....:||:||..:.|:|.||:||.::.::  ...|::..|
Mouse    41 SHEIATNLGDFALRLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQT 105

  Fly   165 SR--LHEQFGLMLQDLQQPTRE-AISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTG 226
            |.  :|:.|..:||.|.:|..| .:|.|                             ||||....
Mouse   106 SEADIHKSFQHLLQTLNRPDSELQLSTG-----------------------------NGLFVNND 141

  Fly   227 YTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILAN 291
            ..|...:.......|.:::...:|..| ..|:..||.:|.:.|:..|...: ..:.|.|...|||
Mouse   142 LKLVEKFLEEAKNHYQAEVFSVNFAES-EEAKKVINDFVEKGTQGKIVEAV-KKLDQDTVFALAN 204

  Fly   292 ALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNL 356
            .:.||..|:..|....|....|:.:...|   ::|.||...|....|....|...::.:.|.||.
Mouse   205 YILFKGKWKQPFDPENTEEAEFHVDESTT---VKVPMMTLSGMLDVHHCSMLSSWVLLMDYAGNT 266

  Fly   357 STMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLG 421
            :.:::: |....::.   |::.|..:.|...:....|..|.:..|::.::.:.||||:|..:|:.
Mouse   267 TAVFLL-PDDGKMQH---LEQTLNKELISQFLLNRRRSDAQIHIPRLSISGNYNLKTLMSPLGIT 327

  Fly   422 GIFSAVQN--DLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQ 484
            .||:   |  |||.|     |..||                      .|.:...|||...|::|.
Mouse   328 RIFN---NGADLSGI-----TEENA----------------------PLKLSKAVHKAVLTIDET 362

  Fly   485 GTEAAASSVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            ||||||::|..:.......:.|.|.||:.::..:.|:..:|.|.:.:|
Mouse   363 GTEAAAATVLQVATYSMPPIVRFDHPFLFIIFEEHTQSPIFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 104/425 (24%)
Serpina1dNP_033272.1 SERPIN 53..410 CDD:214513 103/424 (24%)
RCL 368..387 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.