DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpine1

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:409 Identity:103/409 - (25%)
Similarity:178/409 - (43%) Gaps:68/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IYSPLSIVHSLALLLLGAKGRSYEELSTV--FDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPL 192
            ::||..:...||:|.:...|::..::...  |.:.:....|.        |:|.::|.:.     
Mouse    56 VFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHA--------LRQLSKELMG----- 107

  Fly   193 TDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATA 257
             .|               ..:|:..|:.:|.|....|...:.....:::.:.::..|| .....|
Mouse   108 -PW---------------NKNEISTADAIFVQRDLELVQGFMPHFFKLFQTMVKQVDF-SEVERA 155

  Fly   258 RYNINAYVAQHTKNHIENIIASD-IPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGTE 321
            |:.||.:|.:|||..|.:::|.. :.:.||::|.|||||...|:|.|:|::|....|:.:...| 
Mouse   156 RFIINDWVERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGST- 219

  Fly   322 PVMRVQMMATGGAYPYHE---DHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADK 383
              :.|.|||....:.|.|   ...|...::.|||:|:..:|:|..||:..| .|.||...|.|:.
Mouse   220 --VSVPMMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDV-HLSALTNILDAEL 281

  Fly   384 IESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGN 448
            |......|.|...|:..||..|...|:|:..::::|:..:|||...|.:.::..|          
Mouse   282 IRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQE---------- 336

  Fly   449 SLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSGPDVLFRGDTPFMV 513
                              .|.|...:.||...|||.||.|::|:...:...........|..|:.
Mouse   337 ------------------QLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPTEMVIDRSFLF 383

  Fly   514 LVRHDPTKLVLFYGLINEP 532
            :|||:||:.:||.|.:.||
Mouse   384 VVRHNPTETILFMGQVMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 100/402 (25%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 101/407 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.