DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINA12

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:462 Identity:112/462 - (24%)
Similarity:208/462 - (45%) Gaps:86/462 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VKPSNLPAAYS-----NGYVDLATSDRIANSVLNFANILGQHLA---NGKTQIYSPLSIVHSLAL 142
            :|||..|..|.     .|:.....:..:|...::....|.:.||   .|:....|||||..:.::
Human    21 LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSM 85

  Fly   143 LLLGAKGRSYEELSTVFD---IPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSN 204
            |.|||:..:.:|:...|:   :|:.. |||.|..::.:|.|.|::.                   
Human    86 LCLGAQDSTLDEIKQGFNFRKMPEKD-LHEGFHYIIHELTQKTQDL------------------- 130

  Fly   205 RRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVE----VYASDLQIQDFEGSPATARYNINAYV 265
                     ::.:.|.||..  ..|.|  :|..:|    .|:::..:.:|: :...|:..||.::
Human   131 ---------KLSIGNTLFID--QRLQP--QRKFLEDAKNFYSAETILTNFQ-NLEMAQKQINDFI 181

  Fly   266 AQHTKNHIENIIASDIPQTTRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMA 330
            :|.|...|.|:|.:..|.|. |:|||.::|:|.|:.:|..:.|:.::|:.....:   ::|.||.
Human   182 SQKTHGKINNLIENIDPGTV-MLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSS---VKVPMMF 242

  Fly   331 TGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRA 395
            ..|.|....|.:|.|.|:.:||:.|::.::|: |.:..::.   |:|.|..|......:.:.||.
Human   243 RSGIYQVGYDDKLSCTILEIPYQKNITAIFIL-PDEGKLKH---LEKGLQVDTFSRWKTLLSRRV 303

  Fly   396 ALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAG 460
            ..|:.|::|:|.:.:||..:..:|:..||.. ..||:.||.:.:                     
Human   304 VDVSVPRLHMTGTFDLKKTLSYIGVSKIFEE-HGDLTKIAPHRS--------------------- 346

  Fly   461 TGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLF 525
                   |.|.:.|||.:..::|:|||.||.:..........::.:.|.|:::|:..:....|||
Human   347 -------LKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLF 404

  Fly   526 YGLINEP 532
            .|.|..|
Human   405 LGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 102/425 (24%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 105/441 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.