DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and Serpina6

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:432 Identity:95/432 - (21%)
Similarity:177/432 - (40%) Gaps:94/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SNGYVDLATSDRIANSVLNFANILGQHLA---NGKTQIYSPLSIVHSLALLLLGAKGRS--YEEL 155
            |:.:.|||.::      ::||..|.:.|.   :.|..:.||:||..:||:|.|..:|.:  .|.|
Mouse    28 SSSHRDLAPTN------VDFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENL 86

  Fly   156 STVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANG 220
            .........:.:|:.|..:...|||                :.:.:            |:::.|.
Mouse    87 GFNMSKMSEAEIHQGFQYLNSLLQQ----------------SDTGL------------EMNMGNV 123

  Fly   221 LFTQTGYTLNPDYRRVIVEVYASD-LQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQT 284
            :|......|...:.......|.|: |.|...:.:.|..:  ||.:|...|:..||::: ||:..:
Mouse   124 MFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQ--INNHVKNKTQGKIEHVV-SDLDSS 185

  Fly   285 TRMILANALYFKAFWETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIG 349
            ..:||.|.::.|..|:..|....||.::||.|...|   ::|.||...|...|..|..:.|:::.
Mouse   186 ATLILINYIFLKGIWKLPFSPENTREEDFYVNETST---VKVPMMVQSGNISYFRDSAIPCQMVQ 247

  Fly   350 LPYRGNLSTMYIIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTV 414
            :.|.|| .|.:||.|.:..:..::|...|.|.|:...:   |..|...:..||..::::.:|:.|
Mouse   248 MNYVGN-GTTFIILPDQGQMDTVVAALNRDTIDRWGKL---MIPRQMNLYIPKFSMSDTYDLQDV 308

  Fly   415 MQRMGLGGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDF 479
            :..:|:..:|:. |:|.:     :.|:...|                        ...::||...
Mouse   309 LADVGIKDLFTN-QSDFA-----DTTKDTPL------------------------TLTVLHKAML 343

  Fly   480 TVNEQGTEAAASSVTYLKKSGPDV-------LFRGDTPFMVL 514
            .::|.....||:       :||.|       ..:.:.||:.|
Mouse   344 QLDEGNVLPAAT-------NGPPVHLPSESFTLKYNRPFIFL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 91/417 (22%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 89/411 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.