DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and SERPINA3

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:507 Identity:127/507 - (25%)
Similarity:213/507 - (42%) Gaps:118/507 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VPLQSPGLV-------------NGLGNQNDPALNRISGTSVKPSNLPAAYSNGYVDLATSDRIAN 110
            :||.:.||:             :.|..:|....|:..||              :|||.    :|:
Human     5 LPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGT--------------HVDLG----LAS 51

  Fly   111 SVLNFANILGQHL---ANGKTQIYSPLSIVHSLALLLLGAKGRSYEEL--STVFDIPDTS--RLH 168
            :.::||..|.:.|   |..|..|:|||||..:||.|.|||...:..|:  ...|::.:||  .:|
Human    52 ANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIH 116

  Fly   169 EQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDY 233
            :.|..:|:.|.|.:.|.                            ::.:.|.:|.:...:|...:
Human   117 QSFQHLLRTLNQSSDEL----------------------------QLSMGNAMFVKEQLSLLDRF 153

  Fly   234 RRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAF 298
            ......:|.|:....||:.| |.|:..||.||...|:..|.::| .|:...|.|:|.|.::|||.
Human   154 TEDAKRLYGSEAFATDFQDS-AAAKKLINDYVKNGTRGKITDLI-KDLDSQTMMVLVNYIFFKAK 216

  Fly   299 WETDFIESATRPDNFYPNGEG--TEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYI 361
            ||..|....|....||.:.:.  ..|:|.:..:    ..||..|.||.|.::.|.|.||.|.::|
Human   217 WEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHL----TIPYFRDEELSCTVVELKYTGNASALFI 277

  Fly   362 IQPFKSSVREL--MALQKRLT--ADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGG 422
            : |.:..:.|:  |.|.:.|.  .|.:|      :|....:..||..::...||..::.::|:..
Human   278 L-PDQDKMEEVEAMLLPETLKRWRDSLE------FREIGELYLPKFSISRDYNLNDILLQLGIEE 335

  Fly   423 IFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTE 487
            .|:: :.|||                           |..||| :|.|..:|||....|.|:|||
Human   336 AFTS-KADLS---------------------------GITGAR-NLAVSQVVHKAVLDVFEEGTE 371

  Fly   488 AAASSVTYLKKSGPDV----LFRGDTPFMVLVRHDPTKLVLFYGLINEPPAA 535
            |:|::...:......|    :.|.:.||::::....|:.:.|...:..|..|
Human   372 ASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 112/432 (26%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 118/468 (25%)
RCL 369..394 6/24 (25%)
O-glycosylated at one site 381..389 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.