DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and LOC110439159

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_021329699.1 Gene:LOC110439159 / 110439159 -ID:- Length:275 Species:Danio rerio


Alignment Length:236 Identity:52/236 - (22%)
Similarity:92/236 - (38%) Gaps:35/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 WETDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQ 363
            |:..|....|....|:.:.:.|.|   |||:........:.|.||..|::.|.|..:.|....:.
Zfish    69 WDKPFNRETTSESTFHIDDKTTVP---VQMLHQYERLKVYYDAELSTKVLCLDYNDSFSMFLAVP 130

  Fly   364 PFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQ 428
            ......:.:..|:..::...||.....:..|...:..||:.|..|.:||.:::.||:..:||   
Zfish   131 DVHMGRKTIKDLEMTVSRQHIEKWRRSVSERKVDIYVPKLSLKTSYSLKDILKGMGMADMFS--- 192

  Fly   429 NDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSV 493
                                       .:...||.:...:.|..::||....::|:||.|||.:.
Zfish   193 ---------------------------DKADFTGVSEEKIFVSKVLHKATLDIDEKGTTAAAVTT 230

  Fly   494 TYLK--KSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            .:|:  ...|....|.|.|||:.:.......:||:|.:..|
Zfish   231 VHLRFMSYSPMSDLRFDRPFMIFITDQTNYNILFFGKVVNP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 50/229 (22%)
LOC110439159XP_021329699.1 SERPIN <67..268 CDD:320777 51/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.