DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28Dc and serpinb4

DIOPT Version :9

Sequence 1:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_002936465.2 Gene:serpinb4 / 100490314 XenbaseID:XB-GENE-5787878 Length:392 Species:Xenopus tropicalis


Alignment Length:430 Identity:118/430 - (27%)
Similarity:179/430 - (41%) Gaps:89/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQPTREAISAGRP 191
            |..::|||||..::.|:|||:||.:..|:..||..|                       .:||. 
 Frog    26 KNILFSPLSICSAMGLVLLGSKGDTAAEIEKVFHFP-----------------------AAAGS- 66

  Fly   192 LTDWRASSAMRSNRRAQRPGAH-----------------EVHLANGLFTQTGYTLNPDYRRVIVE 239
                |:|......:..|..|.|                 |:.:||..:.:..:..:..|...|.:
 Frog    67 ----RSSKPSCQQQTCQAQGVHLLFKDLFSTLNKPNDHYELSIANRAYGEKSFPFSEQYLLCIEQ 127

  Fly   240 VYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIA-SDIPQTTRMILANALYFKAFWETDF 303
            :|.:.|:..||:.........|||:|...||..|:|:.| ..:..||.:.|.||:|||..|:..|
 Frog   128 LYNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQF 192

  Fly   304 IESATRPDNFYPN-GEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKS 367
            .:..|....|:.| .:.|.    |:||:..|.|....:.||.|:|:.|||....| |.||.|  .
 Frog   193 KKENTTDAPFFLNKNDKTS----VKMMSQKGKYKLGSNPELKCRILKLPYEEGFS-MKIILP--D 250

  Fly   368 SVRELMALQKRLTADKIESM--ISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQND 430
            .:..|..|:..||.:....:  :.|......:|..|:....|:.:|..|:|.||:          
 Frog   251 DIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGM---------- 305

  Fly   431 LSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASS--- 492
                       |:|..|.:|..:  ..:||       |.:..:|||....|||:||||||::   
 Frog   306 -----------TSAFHGANLSGI--SDKAG-------LAISTVVHKSYIEVNEEGTEAAAATGIG 350

  Fly   493 VTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532
            :|......|...|..|.||:..:.|..||.:||||....|
 Frog   351 ITVTSAPLPPQEFIVDRPFLFCIEHISTKSLLFYGRFTFP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 115/423 (27%)
serpinb4XP_002936465.2 serpinB 10..387 CDD:381072 117/425 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.