DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CBR3

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001227.1 Gene:CBR3 / 874 HGNCID:1549 Length:277 Species:Homo sapiens


Alignment Length:289 Identity:60/289 - (20%)
Similarity:113/289 - (39%) Gaps:72/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHH-GCEIIFACRNRSSAEAAIERIAQER 169
            |||             |.||:||||.|||...||.|... ..:::...|:.:..:||::::..|.
Human     3 SCS-------------RVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEG 54

  Fly   170 PAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVF-----ALPYTRTVDGLETTFQ 229
            .:.    ||..||:..|:|::...:.:::....::.|:.||.|.     .:|:....   |.|.:
Human    55 LSP----RFHQLDIDDLQSIRALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKA---EMTLK 112

  Fly   230 VSHLSHFYLTLQLETLFDYKTRIIVLSS-------------ESHRFANLPVENLAVHHLSPPPEK 281
            .:..:...:..:|..:.....|::.:||             ...||.:   |.|....|....:|
Human   113 TNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHS---ETLTEGDLVDLMKK 174

  Fly   282 Y-------------WSMMAYNNAKL----CNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRN 329
            :             |....|..:||    .:.:.|:.|.::.|...|.|.:..|| .|.:|:.. 
Human   175 FVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILARRLDEKRKADRILVNACCPG-PVKTDMDG- 237

  Fly   330 YWFYRLLFAIVRPFTKSLQQAAATSIYCA 358
                       :...:::::.|.|.:|.|
Human   238 -----------KDSIRTVEEGAETPVYLA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 60/289 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 57/274 (21%)
CBR3NP_001227.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 57/273 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.