DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and CBR1

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001748.1 Gene:CBR1 / 873 HGNCID:1548 Length:277 Species:Homo sapiens


Alignment Length:279 Identity:58/279 - (20%)
Similarity:112/279 - (40%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ALITGANCGIGYETARSLAH-HGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSLR 187
            ||:||.|.|||....|.|.. ...:::...|:.:..:||::::..|..:.    ||..||:..|:
Human     8 ALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSP----RFHQLDIDDLQ 68

  Fly   188 SVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQ--LETLF---- 246
            |::...:.:::....:|.|:.|||:              .|:|:..:.|::..:  ::|.|    
Human    69 SIRALRDFLRKEYGGLDVLVNNAGI--------------AFKVADPTPFHIQAEVTMKTNFFGTR 119

  Fly   247 DYKTRIIVLSSESHRFANLP--VENLAVHHLSPP-PEKY-------------------------- 282
            |..|.::.|.....|..|:.  :...|:...||. .:|:                          
Human   120 DVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVH 184

  Fly   283 ----WSMMAYNNAKL----CNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWFYRLLFAI 339
                |...||...|:    .:.:.|::|:::.|...|.:.:..|| .|.:|::.           
Human   185 QKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPG-WVRTDMAG----------- 237

  Fly   340 VRPFTKSLQQAAATSIYCA 358
             ...|||.::.|.|.:|.|
Human   238 -PKATKSPEEGAETPVYLA 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 58/279 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 58/279 (21%)
CBR1NP_001748.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 58/279 (21%)
Glutathione binding 95..97 1/1 (100%)