DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and PBR1

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_014218.2 Gene:PBR1 / 855540 SGDID:S000005125 Length:407 Species:Saccharomyces cerevisiae


Alignment Length:342 Identity:76/342 - (22%)
Similarity:134/342 - (39%) Gaps:68/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLHGRTALITGANC-GIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFA- 179
            :.|||:..|:|||.. |:|...|..:|..|.::|..  .|...|...|...:.|...::...|. 
Yeast    49 RKLHGKVYLVTGATSQGMGTSVAYKMAELGAQLIIL--TREVDEWVTEWCEELREKTKNELIFVE 111

  Fly   180 ALDLSSLRSVQRFVEE--IKQSVSHIDYLILNAG--------VFALPYTR-TVDGLETTFQVSHL 233
            ..|||:|..:::|...  .......:|.:|:.:|        ..:||..| :.||||.....:::
Yeast   112 KCDLSNLWEIRKFATSWLDNSPPRRLDGVIVMSGDMEPWGIPKISLPQRRSSKDGLELQIATNYV 176

  Fly   234 SHFYLTLQLETLF-----DYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNA-- 291
            :.|:|...|:..|     |...|||:.:.......::.:|           :..|....|.:|  
Yeast   177 AIFHLLNLLQPSFKAQPPDRDVRIILATCWLQVVGDINIE-----------DPLWQNAKYKSALK 230

  Fly   292 -----KLCNVLFAQELAQRWKQ--------------RGISVFSLHPGNMVSSDLSR--------- 328
                 ||...|...||.:|..:              :.:::..:.||.|.|:.|.|         
Yeast   231 FFASSKLQLGLSMMELQRRLTEDIKNQKTNGAERTGKNVTITMVQPGTMRSNSLRRVISNGSVVL 295

  Fly   329 -NYWFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGLS-----GLYFNNCFFCE-PSKLSKSA 386
             ...:..||:.|:..||||.::...:.:|.....||..::     ..|.::|...: ..|.....
Yeast   296 LIILYCILLYPILWLFTKSGRRGDQSFLYALMTPELEEVNLKDTKVKYISDCSIVKFARKEFDDE 360

  Fly   387 ALQQQLWKLSENLIAEL 403
            .||::|:..:|..|.:|
Yeast   361 ELQKKLFDNTERDILQL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 75/339 (22%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 73/335 (22%)
PBR1NP_014218.2 retinol-DH_like_SDR_c_like 53..367 CDD:212492 70/326 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.