DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and YKL107W

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:68/312 - (21%)
Similarity:107/312 - (34%) Gaps:84/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSLRSVQ 190
            |.|...|:|...:|.||.....:....:.....:            .:.:..|...|||      
Yeast    28 IIGGTGGLGRAISRELAQRNARVTVVGQTFRDED------------LKDKINFVKADLS------ 74

  Fly   191 RFVEEIKQSVSHID--------YLILNAGVFALPYTR-TVDGLETTFQVSHLSHFYLTLQLETLF 246
             .|.|.|: :||.|        :||...|:||....: |.:|||....||:||.:.:      ..
Yeast    75 -LVSECKR-ISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYII------FH 131

  Fly   247 DYKTRIIVLSSESHRFANLPVENLA----------VHHLSPPPEKYWSMMAYNNAKLCNVLFAQE 301
            |...|:.:..::..   :||...:|          ...|:...:||.:...:.|....|.....:
Yeast   132 DVAKRLGISRTKKD---DLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVID 193

  Fly   302 LAQRWKQRGISVFSLHPG--------NMVSSD--LSR-NYWFYRLLFAIVRPFTKSLQQAAATSI 355
            ...|:  ..|..|.|:||        |::.||  ||| ..|       |:....:|.:..|.|..
Yeast   194 AKDRY--TNIDTFGLNPGLIKTNIRNNLLGSDTYLSRITEW-------IISWTCQSAETYAKTIC 249

  Fly   356 YCATANELTGLSGLYFNNC----------------FFCEPSKLSKSAALQQQ 391
            ....:..:...||..|:|.                .|.|.|:|....||:.|
Yeast   250 TLIASPAIESRSGTMFSNKGDAILPSPGLTKDVVEKFMENSELLVEKALRNQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 68/312 (22%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 68/312 (22%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 61/294 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.