DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT1G64590

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:314 Identity:111/314 - (35%)
Similarity:163/314 - (51%) Gaps:25/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE 168
            |.|.|||..|....||...||:||||..|||.||||.||..|..::...|:..:||....||..|
plant    17 FGSRSTADHVTCNSDLRSLTAIITGATSGIGAETARVLAKRGARLVLPARSVKTAEETKARILSE 81

  Fly   169 RPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHL 233
            .|.|  ......||||||.||:|||::.:.....::.||.|||.:|..:..:.||:|.||..::|
plant    82 FPDA--EIIVMHLDLSSLTSVRRFVDDFESLNLPLNILINNAGKYAHKHALSEDGVEMTFATNYL 144

  Fly   234 SHFYLT-LQLETLFD------YKTRIIVLSSESHR-FANLPVENLAVHHLSPPPEKYWSMMAYNN 290
            .||.|| |.|:.:.:      .:.||:.::|..|. |:...::.||  .:|.....|.:..||..
plant   145 GHFLLTKLLLKKMIETAAQTGVQGRIVNVTSVVHSWFSGDMLQYLA--DISRNNRNYDATRAYAL 207

  Fly   291 AKLCNVLFAQELAQRWKQRGISVFS--LHPGNMVSSDLSRNYWFYR------LLFAIVRPFTKSL 347
            :||.|||...||::...:...:|.:  :||| :|.:.|:|:    |      |:|.:.....||:
plant   208 SKLANVLHTVELSRLLHKMDANVTANCVHPG-IVKTRLTRD----REGVVTDLVFFLTSKLLKSV 267

  Fly   348 QQAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLIA 401
            .|||||:.|.||:..|..:.|.||::|.....||........|:||..|:.|::
plant   268 PQAAATTCYVATSPRLRNVCGKYFSDCNEARSSKSGSCNLKAQRLWTASDLLVS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 111/314 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 103/297 (35%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 99/285 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3143
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.