DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT1G01800

DIOPT Version :10

Sequence 1:NP_609171.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_563635.1 Gene:AT1G01800 / 839259 AraportID:AT1G01800 Length:295 Species:Arabidopsis thaliana


Alignment Length:300 Identity:61/300 - (20%)
Similarity:114/300 - (38%) Gaps:65/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSL 186
            |.|::||:|.|||:|..|.||::|..::...|:.:...||::::..|...:.....|..||:|:.
plant     5 RVAVVTGSNKGIGFEICRQLANNGITVVLTARDENKGLAAVQKLKTENGFSDQAISFHPLDVSNP 69

  Fly   187 RSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTV-------------------DGLETTFQVSH 232
            .::......:|.....:|.|:.||||........|                   |..|...:...
plant    70 DTIASLAAFVKTRFGKLDILVNNAGVGGANVNVDVLKAQIAEAGAPTDISKIMSDTYEIVEECVK 134

  Fly   233 LSHFYLTLQLETLFDY-----KTRIIVLSSESHRFANL----------PVENLAVHHLSPPPEKY 282
            .:::.:....|.:...     ..||:.::|...:..|:          ..|||....:.....:|
plant   135 TNYYGVKRMCEAMIPLLQSSDSPRIVSIASTMGKLENVSNEWAKGVLSDAENLTEEKIDEVINEY 199

  Fly   283 -------------WS--MMAYNNAKLCNVLFAQELAQRWKQRGISVFSLHPGNMVSSDLSRNYWF 332
                         |.  |..|..:|...:...:.||:|.|  ...:.|:.|| .|:::::.|...
plant   200 LKDYKEGALQVKGWPTVMSGYILSKAAVIALTRVLAKRHK--SFIINSVCPG-FVNTEINFNTGI 261

  Fly   333 YRLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFN 372
            .            |:::.||:.:..|.... ...|||:|:
plant   262 L------------SVEEGAASPVKLALVPN-GDPSGLFFD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_609171.1 WW 13..43 CDD:197736
human_WWOX_like_SDR_c-like 121..402 CDD:187669 61/299 (20%)
AT1G01800NP_563635.1 Rossmann-fold NAD(P)(+)-binding proteins 5..295 CDD:473865 61/299 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.