DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and PORA

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_200230.1 Gene:PORA / 835507 AraportID:AT5G54190 Length:405 Species:Arabidopsis thaliana


Alignment Length:326 Identity:94/326 - (28%)
Similarity:156/326 - (47%) Gaps:53/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHG-CEIIFACRNRSSAEAAIERIAQERPAARSRCRFAA 180
            |.|.....::|||:.|:|..||::||..| ..:|.|||:...|    ||.||.....:.......
plant    88 KTLRKGNVVVTGASSGLGLATAKALAETGKWHVIMACRDFLKA----ERAAQSAGMPKDSYTVMH 148

  Fly   181 LDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVF---ALPYTRTVDGLETTFQVSHLSHFYLT-LQ 241
            |||:||.||::||:..:::...:|.|:.||.|:   |...|.|.:|.|.:..::||.||.|: |.
plant   149 LDLASLDSVRQFVDNFRRAEMPLDVLVCNAAVYQPTANQPTFTAEGFELSVGINHLGHFLLSRLL 213

  Fly   242 LETL--FDYKT-RIIVLSSESHRFANL-----PVENL--------AVHHLSPPP----EKYWSMM 286
            ::.|  .||.: |:|::.|.:.....|     |..||        .::.|:...    ..:....
plant   214 IDDLKNSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLAGGLNGLNSSAMIDGGDFVGAK 278

  Fly   287 AYNNAKLCNVLFAQELAQRW-KQRGISVFSLHPGNMVSSDLSRNYW-FYRLLFAIVRPFTKSL-- 347
            ||.::|:||:|..||..:|: :..||:..||:||.:.::.|.|.:. .:|.||.   ||.|.:  
plant   279 AYKDSKVCNMLTMQEFHRRFHEDTGITFASLYPGCIATTGLFREHIPLFRTLFP---PFQKYITK 340

  Fly   348 ----QQAAATSIYCATANELTGLSGLY---------FNNCFFCEPSKLSKSAALQQQLWKLSENL 399
                :..|...:....|:.....||:|         |.|....|.|.:.|:    :::|::||.|
plant   341 GYVSESEAGKRLAQVVADPSLTKSGVYWSWNKTSASFENQLSQEASDVEKA----RRVWEVSEKL 401

  Fly   400 I 400
            :
plant   402 V 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 94/326 (29%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 92/322 (29%)
PORANP_200230.1 PLN00015 96..403 CDD:177654 92/318 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.