DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT5G53090

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_200121.4 Gene:AT5G53090 / 835389 AraportID:AT5G53090 Length:375 Species:Arabidopsis thaliana


Alignment Length:322 Identity:88/322 - (27%)
Similarity:154/322 - (47%) Gaps:42/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAA--L 181
            |:..|.::||:..|||.||||.||..|..::.|.||..:|...|::..:|...........|  |
plant    54 LNHLTCIVTGSTSGIGRETARQLAEAGARVVMAVRNTKAAHELIQQWQKEWSGKGIPLNLEAMEL 118

  Fly   182 DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTR--TVDGLETTFQVSHLSHFYLTLQL-- 242
            ||.||.||..|.......:|.:..||.|||:|::...:  :.||.|...||:||:...|:|.|  
plant   119 DLLSLDSVVGFCNLWNARLSPLHVLINNAGIFSMGEEQKFSKDGYEQHMQVNHLAPALLSLLLLP 183

  Fly   243 ETLFDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWK 307
            ..:....:|||.::|..|....:..:::   ::.....|:.|::.|:.:||..|:|:..|.:|..
plant   184 SLIRGSPSRIINVNSVMHYVGFVDPDDM---NVVSGKRKFTSLVGYSGSKLAQVMFSNVLLKRLP 245

  Fly   308 -QRGISVFSLHPG---NMVSSDLSRNYWFYRLLFAIVRPFTKSLQQAAATSIYCATANEL----- 363
             :..|||..|.||   ..|:.||.|   :.::.:|::..|..|.|:.:.::::.||..::     
plant   246 LETRISVVCLSPGIVLTNVARDLPR---YVQVQYALIPYFIFSPQEGSRSTLFSATDAQIPEHCE 307

  Fly   364 ----------TGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLIA-------ELVEQEQ 408
                      |.:|    .||...:||:.:.:....:::|:.:..||.       .|:|.|:
plant   308 KLKTEDKPVCTFIS----QNCKHTKPSEEAHNVETAERVWEKTIKLIGLPLDAVERLIEGEE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 85/314 (27%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 84/312 (27%)
AT5G53090NP_200121.4 NADB_Rossmann 60..343 CDD:419666 80/292 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.