DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT5G02540

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_568102.1 Gene:AT5G02540 / 831913 AraportID:AT5G02540 Length:331 Species:Arabidopsis thaliana


Alignment Length:311 Identity:108/311 - (34%)
Similarity:167/311 - (53%) Gaps:24/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE 168
            |.|.|||.:|..|.|....||:|||...|||.||||.|:..|..::...||..:||.|...|.::
plant    16 FGSASTAEEVTQGIDATNLTAIITGGTGGIGMETARVLSKRGAHVVIGARNMGAAENAKTEILRQ 80

  Fly   169 RPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHL 233
            .  |.:|.....|||||::|::.||.|.......::.||.||||...||..:.||:|..|..:|:
plant    81 N--ANARVTLLQLDLSSIKSIKAFVREFHALHLPLNLLINNAGVMFCPYQLSEDGIELQFATNHI 143

  Fly   234 SHFYLT-LQLETLFD-YKT-----RIIVLSSESHRFA-NLPVENLAVHHLSPPPEKYWSMMAYNN 290
            .||.|| |.|:|:.: .||     ||:.:||.:|.:. ...::..:::.:.    .|....||..
plant   144 GHFLLTNLLLDTMKNTAKTSGVEGRILNVSSVAHIYTYQEGIQFDSINDIC----SYSDKRAYGQ 204

  Fly   291 AKLCNVLFAQELAQRWKQRGISVF--SLHPGNMVSSDLSRNYWFYRLLFAIVRPFT----KSLQQ 349
            :||.|:|.|.||:::.::.|:::.  |:|||.:    |:..:....||...::.|:    |::.|
plant   205 SKLANILHANELSRQLQEEGVNITANSVHPGLI----LTNLFQHTALLMRFLKFFSFYLWKNIPQ 265

  Fly   350 AAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLI 400
            .|||:.|.|....:.|::|.||.:|....||||::...|.|:||..|..||
plant   266 GAATTCYVALHPSVKGVTGKYFADCNEVTPSKLARDETLAQKLWDFSVKLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 108/311 (35%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 100/294 (34%)
AT5G02540NP_568102.1 PRK06196 14..315 CDD:235736 106/308 (34%)
retinol-DH_like_SDR_c_like 48..309 CDD:212492 87/270 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.