DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and PORB

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001031731.1 Gene:PORB / 828853 AraportID:AT4G27440 Length:401 Species:Arabidopsis thaliana


Alignment Length:361 Identity:100/361 - (27%)
Similarity:176/361 - (48%) Gaps:59/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LAFAVEEPTQNVA-QVRQRFDSCSTALQVLHG-KDLHGRTALITGANCGIGYETARSLAHHG-CE 147
            |.|..|:..:|:| :.:....|..|..:.:.| |.|.....::|||:.|:|..||::||..| ..
plant    51 LRFKREQSLRNLAIRAQTAATSSPTVTKSVDGKKTLRKGNVVVTGASSGLGLATAKALAETGKWN 115

  Fly   148 IIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGV 212
            :|.|||:...||.|.:.:...:.:    .....|||:||.||::||:..:::.:.:|.|:.||.|
plant   116 VIMACRDFLKAERAAKSVGMPKDS----YTVMHLDLASLDSVRQFVDNFRRTETPLDVLVCNAAV 176

  Fly   213 F---ALPYTRTVDGLETTFQVSHLSHFYLT-LQLETL--FDYKT-RIIVLSSESHRFANL----- 265
            :   |...|.:.:|.|.:...:||.||.|. |.|:.|  .||.: |:|::.|.:.....|     
plant   177 YFPTAKEPTYSAEGFELSVATNHLGHFLLARLLLDDLKKSDYPSKRLIIVGSITGNTNTLAGNVP 241

  Fly   266 PVENL--------AVHHLSPPPEKYWSMM----------AYNNAKLCNVLFAQELAQRW-KQRGI 311
            |..||        .::.|:.      |.|          ||.::|:||:|..||..:|: ::.|:
plant   242 PKANLGDLRGLAGGLNGLNS------SAMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGV 300

  Fly   312 SVFSLHPGNMVSSDLSRNYW-FYRLLFAIVRPFTKSL------QQAAATSIYCATANELTGLSGL 369
            :..||:||.:.|:.|.|.:. .:|.||.   ||.|.:      :..:...:....::.....||:
plant   301 TFASLYPGCIASTGLFREHIPLFRALFP---PFQKYITKGYVSETESGKRLAQVVSDPSLTKSGV 362

  Fly   370 Y--FNNCFFCEPSKLSKSAA---LQQQLWKLSENLI 400
            |  :||......::||:.|:   ..:::|::||.|:
plant   363 YWSWNNASASFENQLSEEASDVEKARKVWEISEKLV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736 100/361 (28%)
PRK06196 104..402 CDD:235736 95/342 (28%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 90/324 (28%)
PORBNP_001031731.1 PLN00015 92..399 CDD:177654 90/320 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.