DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT4G24050

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_194136.1 Gene:AT4G24050 / 828505 AraportID:AT4G24050 Length:332 Species:Arabidopsis thaliana


Alignment Length:311 Identity:114/311 - (36%)
Similarity:167/311 - (53%) Gaps:17/311 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE 168
            |.|.|||.:|....||...||:||||..|||.||||.||..|..:||..||..:||.|.|||..|
plant    17 FGSKSTAEEVTENCDLRSITAVITGATSGIGAETARVLAKRGARLIFPARNVKAAEEAKERIVSE 81

  Fly   169 RPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHL 233
            .|  .:......|||||:.||:.||.:.:.....::.||.|||..|..:..:.||:|.||..::|
plant    82 FP--ETEIVVMKLDLSSIASVRNFVADFESLDLPLNLLINNAGKLAHEHAISEDGIEMTFATNYL 144

  Fly   234 SHFYLT-------LQLETLFDYKTRIIVLSSESHR-FANLPVENLAVHHLSPPPEKYWSMMAYNN 290
            .||.||       :|.......:.||:.::|..|. |:...:|.|.:  :|.|..::.:..||..
plant   145 GHFLLTNLLLNKMIQTAEETGVQGRIVNVTSGIHGWFSGDLIEYLRL--ISQPKCQFDATRAYAL 207

  Fly   291 AKLCNVLFAQELAQRWKQRG--ISVFSLHPGNMVSSDLSRNY--WFYRLLFAIVRPFTKSLQQAA 351
            :||.|||..:||:.|.::.|  ::|..:||| :|.:.|:|:.  ....|:|.:.....|::.|||
plant   208 SKLANVLHTKELSSRLQKIGANVTVNCVHPG-VVRTRLTRDREGLLTDLVFFLASKLVKTVPQAA 271

  Fly   352 ATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENLIAE 402
            ||:.|.||...|..:||.||.:|....||.|..:::...:||..||.|:.:
plant   272 ATTCYVATNPRLVNVSGKYFTDCNETTPSGLGTNSSEATKLWAASEILVTQ 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 114/309 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 106/292 (36%)
AT4G24050NP_194136.1 PRK06197 36..319 CDD:235737 105/287 (37%)
retinol-DH_like_SDR_c_like 36..313 CDD:212492 101/281 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.