DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and Tic32-IVa

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_849428.1 Gene:Tic32-IVa / 828442 AraportID:AT4G23430 Length:322 Species:Arabidopsis thaliana


Alignment Length:307 Identity:117/307 - (38%)
Similarity:172/307 - (56%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQE 168
            |.|.|||.:|.||.|..|.||::|||:.|||.||||.|:..|..::.|.||..|.....|.|.::
plant    12 FSSRSTAEEVTHGVDGTGLTAIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQ 76

  Fly   169 RPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHL 233
            .|.|  :.....|||||::||::|..|.|.:...::.||.|||:.|.|:..:.|.:|..|..:||
plant    77 VPGA--KLDVMELDLSSMQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHL 139

  Fly   234 SHFYLT-LQLETL------FDYKTRIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNA 291
            .||.|| |.|:|:      ...:.||:.||||:||| :.| |.:....:: ....|.||.||..:
plant   140 GHFLLTKLLLDTMKSTSRESKREGRIVNLSSEAHRF-SYP-EGVRFDKIN-DKSSYSSMRAYGQS 201

  Fly   292 KLCNVLFAQELAQRWKQRGISVF--SLHPGNMVSSDLSR--NYWFYRLLFAIVRPFTKSLQQAAA 352
            ||||||.|.||.::.|:.|:::.  ||||| .:.::|.|  |.:....:.|:.:...||:.|.||
plant   202 KLCNVLHANELTKQLKEDGVNITANSLHPG-AIMTNLGRYFNPYLAVAVGAVAKYILKSVPQGAA 265

  Fly   353 TSIYCATANELTGLSGLYFNNCFFCEPSKLSKSAALQQQLWKLSENL 399
            |:.|.|...::.|:||.||.:....:|..|.|...|.:::|..|..|
plant   266 TTCYVALNPQVAGVSGEYFQDSNIAKPLPLVKDTELAKKVWDFSTKL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 117/307 (38%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 108/290 (37%)
Tic32-IVaNP_849428.1 retinol-DH_like_SDR_c_like 29..306 CDD:212492 105/282 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3143
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.