DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wwox and AT4G23420

DIOPT Version :9

Sequence 1:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001190811.1 Gene:AT4G23420 / 828441 AraportID:AT4G23420 Length:333 Species:Arabidopsis thaliana


Alignment Length:338 Identity:117/338 - (34%)
Similarity:183/338 - (54%) Gaps:25/338 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QQRTNVDPRLAFAVEEPTQNVAQVRQRFDSCSTALQVLHGKDLHGRTALITGANCGIGYETARSL 141
            |....:...:...:::...|.:|....|.|.|||.:|.||.|..|.||::|||:.|||.||||.|
plant     2 QSSNQISTEILRPLKKKIPNKSQRASGFSSRSTAEEVTHGVDGTGLTAIVTGASSGIGVETARVL 66

  Fly   142 AHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSLRSVQRFVEEIKQSVSHIDYL 206
            |..|..::.|.||..:.....|.|.::.|.|  :.....|:|||:.||::|..|.|.:...::.|
plant    67 ALRGVHVVMAVRNTGAGAKVKEDIVKQVPGA--KVDVMELELSSMESVRKFASEYKSAGLPLNLL 129

  Fly   207 ILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT-LQLETLFD------YKTRIIVLSSESHRFAN 264
            |.|||:.|.|:..:.|.:|..|..:||.||.|| |.|:|:.:      .:.||:.:|||:||: :
plant   130 INNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKNTSRESKREGRIVNVSSEAHRY-S 193

  Fly   265 LPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGISVF--SLHPGNMVSSDLS 327
            .| |.:....:: ....|.|:.||..:||||||.|.|||::.|:.|:::.  |||||.:::    
plant   194 YP-EGVRFDKIN-DESSYSSIRAYGQSKLCNVLHANELAKQLKEDGVNITANSLHPGAIMT---- 252

  Fly   328 RNYWFY------RLLFAIVRPFTKSLQQAAATSIYCATANELTGLSGLYFNNCFFCEPSKLSKSA 386
             |.|.|      ..:.|:.:...||:.|.|||:.|.|...::.|::|.||::....:|.:|.|..
plant   253 -NLWGYFNSYLAGAVGAVAKYMVKSVPQGAATTCYVALNPQVAGVTGEYFSDSNIAKPIELVKDT 316

  Fly   387 ALQQQLWKLSENL 399
            .|.::||..|..|
plant   317 ELAKKLWDFSTKL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736 1/8 (13%)
PRK06196 104..402 CDD:235736 114/311 (37%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 105/294 (36%)
AT4G23420NP_001190811.1 PRK06197 43..331 CDD:235737 106/297 (36%)
retinol-DH_like_SDR_c_like 46..323 CDD:212492 101/286 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3143
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.